PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00015438-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family M-type_MADS
Protein Properties Length: 89aa    MW: 10005.7 Da    PI: 10.5414
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00015438-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.73.1e-28959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        krie+ks rqvtfskR+ g++KKA EL vLCd+eva++ifs +g+lye+ss
  WALNUT_00015438-RA  9 KRIEDKSSRQVTFSKRKGGLMKKARELAVLCDVEVALMIFSDRGRLYEFSS 59
                        79***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.23161IPR002100Transcription factor, MADS-box
SMARTSM004321.8E-36160IPR002100Transcription factor, MADS-box
CDDcd002654.67E-35259No hitNo description
SuperFamilySSF554552.49E-28267IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-29323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-293859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MGRGKVQLKR IEDKSSRQVT FSKRKGGLMK KARELAVLCD VEVALMIFSD RGRLYEFSSA  60
ERLAFLELSP THLPPPPGES SNEKQKVLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S7e-22172176Myocyte-specific enhancer factor 2B
1tqe_R7e-22172176Myocyte-specific enhancer factor 2B
1tqe_Q7e-22172176Myocyte-specific enhancer factor 2B
1tqe_P7e-22172176Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7297951e-98KF729795.1 Juglans regia cultivar Wuhuo06 flowering locus C-like protein (FLC) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007043954.14e-30Flowering locus C, putative isoform 1
SwissprotA2Y9P03e-27MADS5_ORYSI; MADS-box transcription factor 5
SwissprotQ0DEB83e-27MADS5_ORYSJ; MADS-box transcription factor 5
SwissprotQ8RU316e-27MAD21_ORYSJ; MADS-box transcription factor 21
TrEMBLW0FFX13e-37W0FFX1_9R
STRINGSolyc05g015730.1.12e-28(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11933360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03710.34e-28MIKC_MADS family protein